PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.007G047900.1
Common NamePHAVU_007G047900g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family M-type_MADS
Protein Properties Length: 304aa    MW: 34338.2 Da    PI: 9.3006
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.007G047900.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF70.11.9e-2262110149
                         S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
              SRF-TF   1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49 
                         k+ +n+sn qvtfskRr g++KKA+EL++LC+a va+++fs+  k++ +
  Phvul.007G047900.1  62 KKMSNESNLQVTFSKRRSGLFKKASELCTLCGAHVALVVFSPGEKVFSF 110
                         5689***************************************999887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006624.654114IPR002100Transcription factor, MADS-box
SMARTSM004323.1E-3354113IPR002100Transcription factor, MADS-box
CDDcd002653.17E-3455123No hitNo description
SuperFamilySSF554552.09E-2755128IPR002100Transcription factor, MADS-box
PRINTSPR004044.5E-195676IPR002100Transcription factor, MADS-box
PfamPF003192.6E-2464110IPR002100Transcription factor, MADS-box
PRINTSPR004044.5E-197691IPR002100Transcription factor, MADS-box
PRINTSPR004044.5E-1991112IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009960Biological Processendosperm development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 304 aa     Download sequence    Send to blast
MKKNKNLVVF VRPFRDACCF GCLHLQTQNT YKFSSPQRHI LCCDTMDSGA KKSRGRQKIE  60
MKKMSNESNL QVTFSKRRSG LFKKASELCT LCGAHVALVV FSPGEKVFSF GHPNVDAVID  120
RFLGRAPVQD SGTMQFIDAH RISNVRDLNK QLTQVNELLE TERKRGEELS RLRKEAQELM  180
WWTRPTEELS VEQMEQYKAA LEELKKHVAQ LAERAMLQSA VNQGHQFFPG TSSSANFVPQ  240
SQHQHQHQPQ PQPPQVFTAQ TIPSILQNYM FPDVTIMQQQ HHGFDNMGMG GYGPGPAPAA  300
GFF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150410.0AP015041.1 Vigna angularis var. angularis DNA, chromosome 8, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007143149.10.0hypothetical protein PHAVU_007G047900g
SwissprotQ9FKK21e-64AGL62_ARATH; Agamous-like MADS-box protein AGL62
TrEMBLV7BE210.0V7BE21_PHAVU; Uncharacterized protein
STRINGGLYMA10G40080.11e-111(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF12833331
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.11e-65AGAMOUS-like 62